DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Psmb10

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:174 Identity:57/174 - (32%)
Similarity:84/174 - (48%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECR 137
            |||..|..|:.||:|..|:|||..|.:..:|.:||..|...:....||.|||.....|:.:.:..
Mouse    39 GTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAASKME 103

  Fly   138 LHELRNKERISVAAASKIMANIAHEYKG-MGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFSV 201
            ||.|.......||..::|:......|:| :|.|  :::.|.|..||.||.|...||.:.....::
Mouse   104 LHALSTGREPRVATVTRILRQTLFRYQGHVGAS--LVVGGVDLNGPQLYEVHPHGSYSRLPFTAL 166

  Fly   202 GSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGG 245
            |||...|..:|:..:..::..:.||||...||......|..|||
Mouse   167 GSGQGAAVALLEDRFQPNMTLEAAQELLVEAITAGILSDLGSGG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 57/174 (33%)
proteasome_beta_type_5 74..261 CDD:239730 56/173 (32%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 57/174 (33%)
proteasome_beta_type_7 40..226 CDD:239732 56/173 (32%)
Pr_beta_C 232..267 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.