DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Psma3

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_035314.3 Gene:Psma3 / 19167 MGIID:104883 Length:255 Species:Mus musculus


Alignment Length:276 Identity:56/276 - (20%)
Similarity:100/276 - (36%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MCNLANPYTLAAPPFENPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGS 97
            |.::...|.|:|..| :|...:.|::     ..:|. .::.:|.:|.:.|.||:..|:.......
Mouse     1 MSSIGTGYDLSASTF-SPDGRVFQVE-----YAMKA-VENSSTAIGIRCKDGVVFGVEKLVLSKL 58

  Fly    98 YIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVAAASKIMANIAHE 162
            | ...|.|::..:::.:...:||..||......:..:|...........|.:...:..:|...|.
Mouse    59 Y-EEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHA 122

  Fly   163 Y------KGMGLSMGMMLAGYDKR-GPGLYYVDSEGSRTPGNLFSVGSGSLYAYGVLDSGYHWDL 220
            |      :..|.|  .||..|... |..||.:|..|               .:||      :|..
Mouse   123 YTLYSAVRPFGCS--FMLGSYSANDGAQLYMIDPSG---------------VSYG------YWGC 164

  Fly   221 EDKEAQ-----ELGRRAIYHATFRDAYS--GGIIRVYH--IK------EDGWVNISNTDCMEL-- 268
            ...:|:     |:.:..:...|.||...  ..||.:.|  :|      |..||.       ||  
Mouse   165 AIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVG-------ELTK 222

  Fly   269 --HYMYQEQLKQQAAK 282
              |.:..:.::::|.|
Mouse   223 GRHEIVPKDIREEAEK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 53/259 (20%)
proteasome_beta_type_5 74..261 CDD:239730 43/208 (21%)
Psma3NP_035314.3 proteasome_alpha_type_3 5..217 CDD:239720 48/242 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.