DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and pas-6

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_504472.1 Gene:pas-6 / 178943 WormBaseID:WBGene00003927 Length:260 Species:Caenorhabditis elegans


Alignment Length:175 Identity:44/175 - (25%)
Similarity:71/175 - (40%) Gaps:16/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECR 137
            |:.|:|.|.:...::....||....   |...||:.||:.....::||..:|.....|.|..||.
 Worm    32 GSATVGIKSETHAVIVALKRAQNDL---SSHQKKVYEIDTHAGVSIAGLLSDGRILARYLQTECS 93

  Fly   138 LHELRNKERISVAAAS-----KIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGN 197
            ......|:.:.:...:     |:.||..: |......:|:::|||||.|..:...|........:
 Worm    94 SWRWDYKQAVPIKKLAESMQLKLQANTQY-YGRRPFGVGILIAGYDKDGAHIIQTDPSAEVVSMH 157

  Fly   198 LFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHA--TFRD 240
            ..|:|:.|..|...|:...  |..:|...|   :.|.||  ..||
 Worm   158 GTSIGARSQSARTYLERNV--DNFEKSTPE---QLIVHALLALRD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 44/175 (25%)
proteasome_beta_type_5 74..261 CDD:239730 43/174 (25%)
pas-6NP_504472.1 PRE1 4..237 CDD:223711 44/175 (25%)
proteasome_alpha_type_1 6..216 CDD:239718 44/175 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.