DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5 and Psmb8

DIOPT Version :9

Sequence 1:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_034854.2 Gene:Psmb8 / 16913 MGIID:1346527 Length:276 Species:Mus musculus


Alignment Length:278 Identity:145/278 - (52%)
Similarity:190/278 - (68%) Gaps:9/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALAEICKISNAPYMRPNAWSSADV---EEEQKGLMCNLANPYTLAAPPFENPLHNLNQIQANGD 62
            |||.::|..:..  .||. |::.|.   .....|.....|....||.|....|...|...  .||
Mouse     1 MALLDLCGAARG--QRPE-WAALDAGSGGRSDPGHYSFSAQAPELALPRGMQPTAFLRSF--GGD 60

  Fly    63 -KTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCV 126
             :..|:|...||||||.|||:.||::|||||||.||||.|..|.|::|||.::|||::|.||||.
Mouse    61 QERNVQIEMAHGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIEINPYLLGTMSGCAADCQ 125

  Fly   127 YWDRVLSKECRLHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEG 191
            ||:|:|:|||||:.|||.|||||:||||:::|:..:|:|||||||.|:.|:||:||||||||..|
Mouse   126 YWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKKGPGLYYVDDNG 190

  Fly   192 SRTPGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDG 256
            :|..|.:||.|||:.|||||:||||..||..:||.:||||||.:||.||.||||::.:||:||||
Mouse   191 TRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLGRRAIAYATHRDNYSGGVVNMYHMKEDG 255

  Fly   257 WVNISNTDCMELHYMYQE 274
            ||.:.::|..:|.|.|.|
Mouse   256 WVKVESSDVSDLLYKYGE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 133/234 (57%)
proteasome_beta_type_5 74..261 CDD:239730 119/186 (64%)
Psmb8NP_034854.2 PTZ00488 40..271 CDD:185666 133/232 (57%)
proteasome_beta_type_5 73..260 CDD:239730 119/186 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 272 1.000 Domainoid score I1793
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 294 1.000 Inparanoid score I2731
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm8748
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1013
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.