powered by:
Protein Alignment cathD and YGL258W-A
DIOPT Version :9
Sequence 1: | NP_001334713.1 |
Gene: | cathD / 45268 |
FlyBaseID: | FBgn0029093 |
Length: | 392 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_076890.1 |
Gene: | YGL258W-A / 852633 |
SGDID: | S000007607 |
Length: | 77 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 54 |
Identity: | 18/54 - (33%) |
Similarity: | 26/54 - (48%) |
Gaps: | 4/54 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 200 AMYEQGLISAPV-FSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAY 252
|...||.|...: :|.:|| ..:...|.|:||..|.:.|..|....|: |:||
Yeast 2 AFERQGKIEKKISYSLFLN--GPNVHFGSILFGAVDKSKYAEELCTHPM-RQAY 52
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1339 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000066 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.