DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and YPS3

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_013222.1 Gene:YPS3 / 850812 SGDID:S000004111 Length:508 Species:Saccharomyces cerevisiae


Alignment Length:428 Identity:112/428 - (26%)
Similarity:173/428 - (40%) Gaps:70/428 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVALLLVAFLAAAVAHPNSQEKPG--LLRVPLHKFQSARRHFADVGTELQQLRIRYGGGDVPEPL 65
            |:.|..||.||...:....:..|.  .:::|..|.::     .|.| ||.    :...|.....|
Yeast     2 KLQLAAVATLAVLTSPAFGRVLPDGKYVKIPFTKKKN-----GDNG-ELS----KRSNGHEKFVL 56

  Fly    66 SNYMDAQYYG-PIAIGSPPQNFRVVFDTGSSNLWVPSK---KCHLTNIACLMHNKYDASKSKTYT 126
            :|  :..:|. .:|||:|.||..|:.||||::||||.|   .|. :.:.|..:..:|.:||.|:.
Yeast    57 AN--EQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCG-SVMDCDQYGVFDKTKSSTFK 118

  Fly   127 KN-GTEFAIQYGSGSLS-GYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSI 189
            .| .:.|...||.|:.: |....|.:....||:...:||.| :|....|      |:||:|.:::
Yeast   119 ANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAVA-NESNSTF------GVLGIGLSTL 176

  Fly   190 SV---DKVKPPFYAMYE----------QGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGE 241
            .|   .||.......||          .|.|.|..:|.:||.:  |...|.|:||..|.:.|.|:
Yeast   177 EVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDE--SQSSGSILFGAVDHSKYEGQ 239

  Fly   242 FTYLPVTR----KAYWQ-IKMDAASIG--------DLQLCKGGCQVIADTGTSLIAAPLEE---- 289
            ...:|:..    :.|.. :..|....|        ::.|.......:.|:||:|...|.:.    
Yeast   240 LYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALL 304

  Fly   290 ATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMG 354
            |.|:|.....|.   |.|..:|........:.|..||........|:.:   |.....|:...  
Yeast   305 AKSLNASYSKTL---GYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTM---QTSVGTCVLAI-- 361

  Fly   355 LDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADAK 392
              ||.......||||.|:...|..:|:.|..:..|.||
Yeast   362 --IPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
YPS3NP_013222.1 SAP_like 61..396 CDD:133141 94/354 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S917
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X163
TreeFam 1 0.960 - -
65.720

Return to query results.
Submit another query.