DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and AT4G22050

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_193936.2 Gene:AT4G22050 / 828294 AraportID:AT4G22050 Length:354 Species:Arabidopsis thaliana


Alignment Length:397 Identity:139/397 - (35%)
Similarity:199/397 - (50%) Gaps:69/397 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTELQQLRIRYGGGDVPEPLSNYMDAQ 72
            :.:||:.:.|         |:|:||.     ..|......:..||:             |..|..
plant     8 IFSFLSVSEA---------LVRIPLQ-----IDHALSTNNDGVQLK-------------NVKDFL 45

  Fly    73 YYGPIAIGSPPQNFRVVFDTGSSNLWVPSKK--CHLTNIACLMHNKYDASKSKTYTKNGTEFAIQ 135
            |||.|.||:|.|.|.|:||||||:|||||:.  ....|    ..|:|.:|.|:|:.:|||:..::
plant    46 YYGKIQIGNPGQTFTVLFDTGSSSLWVPSENWLAKTEN----PRNRYISSASRTFKENGTKAELK 106

  Fly   136 YGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEP-GLVFVAAKFDGILGLGYN-----SISVDKV 194
            ||.|||:|:||.|||::.|:.|..|||.|.:..| ...|....|||||||.:.     ..||   
plant   107 YGKGSLTGFLSVDTVTVGGISITSQTFIEGVKTPYKEFFKKMPFDGILGLRFTDPLNFGTSV--- 168

  Fly   195 KPPFYAMYEQGLISAPVFSFYLNRDPASPE--GGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKM 257
               :::|..||.|:..|||.:|.|...|.|  |||::|||..|.|::|:.||:.|.....: ..|
plant   169 ---WHSMVFQGKIAKNVFSIWLRRFSNSGEINGGEVVFGGIIPAHFSGDHTYVDVEGPGNF-FAM 229

  Fly   258 DAASIG--DLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVI 320
            ....:|  :..:|..||:.|.|:|:|.|..|::.|..|::.||..|        :|:....||.:
plant   230 SNIWVGGKNTNICSSGCKAIVDSGSSNINVPMDSADEIHRYIGVEP--------NCNNFETLPDV 286

  Fly   321 KFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGND- 384
            .|.:|||.|.|...|||.|    .::.|.|.|:|    ..|...|.||..|:..::|.||..|. 
plant   287 TFTIGGKAFVLTPLDYIRR----SRSQCTSKFVG----KTNRSHWTLGIPFMRVFHTVFDYQNTL 343

  Fly   385 --RVGFA 389
              :||||
plant   344 AVKVGFA 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
AT4G22050NP_193936.2 pepsin_retropepsin_like 36..351 CDD:386101 131/355 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.