DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and AT3G50050

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_190574.1 Gene:AT3G50050 / 824167 AraportID:AT3G50050 Length:632 Species:Arabidopsis thaliana


Alignment Length:430 Identity:104/430 - (24%)
Similarity:163/430 - (37%) Gaps:106/430 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VAHPNSQEKPGLLRVP---LHKFQSARRHFADVGTELQQLRIRYGGGDVPEPLSNYMD----AQY 73
            ::.|||..:.  :.:|   |||..|         ..|...|:|.           |.|    ..|
plant    51 LSQPNSSSRS--ISIPHRKLHKSDS---------KSLPHSRMRL-----------YDDLLINGYY 93

  Fly    74 YGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHN--KYDASKSKTY----------- 125
            ...:.||:|||.|.::.|:||:..:||...|.    .|..|.  |:....|.||           
plant    94 TTRLWIGTPPQMFALIVDSGSTVTYVPCSDCE----QCGKHQDPKFQPEMSSTYQPVKCNMDCNC 154

  Fly   126 --TKNGTEFAIQYGSGSLS-GYLSTDTVSIAG---LDIKDQTFAEALSEPGLVFVAAKFDGILGL 184
              .:....:..:|...|.| |.|..|.:|...   |..:...|.....|.|.:: :.:.|||:||
plant   155 DDDREQCVYEREYAEHSSSKGVLGEDLISFGNESQLTPQRAVFGCETVETGDLY-SQRADGIIGL 218

  Fly   185 GYNSIS-VDKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGE--FTYLP 246
            |...:| ||:       :.::||||.   ||.|........||.:|.||.|   |..:  ||...
plant   219 GQGDLSLVDQ-------LVDKGLISN---SFGLCYGGMDVGGGSMILGGFD---YPSDMVFTDSD 270

  Fly   247 VTRKAYWQIKMDAASIGDLQLC------KGGCQVIADTGTSLIAAP-----------LEEATSIN 294
            ..|..|:.|.:....:...||.      .|....:.|:||:....|           :.|.:::.
plant   271 PDRSPYYNIDLTGIRVAGKQLSLHSRVFDGEHGAVLDSGTTYAYLPDAAFAAFEEAVMREVSTLK 335

  Fly   295 QKIGGTP--------IIGGQYVVSCDLIPQLPVIKFVL-GGKTFELEGKDYILRVAQMGKTICLS 350
            |..|..|        :....||  .:|....|.::.|. .|:::.|..::|:.|.:::....||.
plant   336 QIDGPDPNFKDTCFQVAASNYV--SELSKIFPSVEMVFKSGQSWLLSPENYMFRHSKVHGAYCLG 398

  Fly   351 GFMGLDIPPPNGP--LWILGDVFIGKYYTEFDMGNDRVGF 388
            .|       |||.  ..:||.:.:......:|..|.:|||
plant   399 VF-------PNGKDHTTLLGGIVVRNTLVVYDRENSKVGF 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
AT3G50050NP_190574.1 pepsin_A_like_plant 92..436 CDD:133143 91/367 (25%)
Asp 92..431 CDD:278455 89/365 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.