DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and Pga5

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_067428.2 Gene:Pga5 / 58803 MGIID:1915935 Length:387 Species:Mus musculus


Alignment Length:385 Identity:148/385 - (38%)
Similarity:215/385 - (55%) Gaps:34/385 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLRVPLHKFQSARRHFAD---------------VGTELQQLR---IRYGGGDVPEPLSNYMDAQY 73
            |:::||.|.:|.|.:..:               ....|:|.|   :.|      ||:.||:|..|
Mouse    16 LVKIPLMKIKSMRENLRESQVLKDYLEKYPRSRAHVLLEQRRNPAVTY------EPMRNYLDLVY 74

  Fly    74 YGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGS 138
            .|.|:||:|||.||||.|||||.|||||..|  ::.||..|..::..:|.|:..:|....:.|||
Mouse    75 IGIISIGTPPQEFRVVLDTGSSVLWVPSIYC--SSPACAHHKAFNPLRSSTFLVSGRPVNVAYGS 137

  Fly   139 GSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYAMYE 203
            |.:||:|:.|||.|..|.:..|.|..:|.|||:....|.|||||||||.::.:..:.|.|..::.
Mouse   138 GEMSGFLAYDTVRIGDLTVVAQAFGLSLEEPGIFMEYAVFDGILGLGYPNLGLQGITPVFDNLWL 202

  Fly   204 QGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKMDAASI-GDLQL 267
            ||||...:|:|||:  ....:|..::.||.||::|.||..::||::.:|||:.:|:.|: |::..
Mouse   203 QGLIPQNLFAFYLS--SKDEKGSMLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDSISMNGEVIA 265

  Fly   268 CKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFELE 332
            |.||||.|.||||||:..|.....:|...||......|:|.:.||.|..||.|.|.:|..|:.:.
Mouse   266 CDGGCQGIMDTGTSLLTGPRSSIVNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTIGSVTYPVP 330

  Fly   333 GKDYILRVAQMGKTICLSGF-MGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADA 391
            ...||.:.....   |.|.| .|:| .|.:..:|:|||||:..|:|.||..|:|:|.|.|
Mouse   331 ASAYIRKDRSHN---CRSNFEEGMD-DPSDPEMWVLGDVFLRLYFTVFDRANNRIGLAPA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
Pga5NP_067428.2 A1_Propeptide 16..44 CDD:285240 6/27 (22%)
pepsin_retropepsin_like 64..385 CDD:299705 136/328 (41%)
Asp 74..386 CDD:278455 132/319 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.