DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and Cym

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_064476.2 Gene:Cym / 56825 RGDID:708486 Length:379 Species:Rattus norvegicus


Alignment Length:397 Identity:141/397 - (35%)
Similarity:215/397 - (54%) Gaps:34/397 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTELQQLRIRYG----------GGD 60
            :||:|.||.|.:|.       :.|:||||.:|.|....:.|. |:....|:.          |..
  Rat     5 VLLLAVLAIAQSHV-------VTRIPLHKGKSLRNTLKEQGL-LEDFLRRHQYEFSEKNSNIGVV 61

  Fly    61 VPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTY 125
            ..|||:||:|::|:|.|.:|:|||.|:||||||||.|||||..|  ::..|..||::|.|||.|:
  Rat    62 ASEPLTNYLDSEYFGLIYVGTPPQEFKVVFDTGSSELWVPSVYC--SSKVCRNHNRFDPSKSFTF 124

  Fly   126 TKNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSIS 190
            ........:|||:||:.|:|:.|||:::.:.:..||...:..|||.:|..:.|||||||.|.:.:
  Rat   125 QNLSKPLFVQYGTGSVEGFLAYDTVTVSDIVVPHQTVGLSTEEPGDIFTYSPFDGILGLAYPTFA 189

  Fly   191 VDKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQI 255
            .....|.|..|..:.|::..:||.|::|   :.:|..:..|..|.:::.|...::|||.:.|||.
  Rat   190 SKYSVPIFDNMMNRHLVAQDLFSVYMSR---NDQGSMLTLGAIDQSYFIGSLHWVPVTVQGYWQF 251

  Fly   256 KMDAASIGD-LQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPV 319
            .:|..:|.| :..|:|||..:.||||:|:..|..:..:|...||.......|:.:.|..:..:|.
  Rat   252 TVDRITINDEVVACQGGCPAVLDTGTALLTGPGRDILNIQHAIGAVQGQHDQFDIDCWRLNFMPT 316

  Fly   320 IKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGND 384
            :.|.:.|:.|.|....|    ....:..|.|||.      ....:||||||||.::|:.||..|:
  Rat   317 VVFEINGREFPLPPSAY----TNQFQGSCSSGFR------HGSQMWILGDVFIREFYSVFDRANN 371

  Fly   385 RVGFADA 391
            |||.|.|
  Rat   372 RVGLAKA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
CymNP_064476.2 A1_Propeptide 19..47 CDD:400357 9/28 (32%)
pepsin_retropepsin_like 64..377 CDD:416259 121/327 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.