DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and PGA5

DIOPT Version :10

Sequence 1:NP_652013.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_055039.1 Gene:PGA5 / 5222 HGNCID:8887 Length:388 Species:Homo sapiens


Alignment Length:106 Identity:28/106 - (26%)
Similarity:40/106 - (37%) Gaps:27/106 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   859 GLGGKFSTAGAISLSVPSPSSPPISSSCGIAKLQLL----INGPNGIQVLLTEDVLNNVKDETLF 919
            |..||...|...||.:......||.|.|...:|||:    :.|..|.:||.|     .|.|| :|
Human    10 GESGKSVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLYT-----TVNDE-IF 68

  Fly   920 QLELKSNG-----------------NILMKAVHSVTAAGGP 943
            .|....:|                 ::..|.:.|::...||
Human    69 VLGTNCSGCLGVGDIQSTIEPRRLDSLTGKKIASLSYGSGP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_652013.1 A1_Propeptide 29..56 CDD:462326
pepsin_retropepsin_like 62..389 CDD:472175
PGA5NP_055039.1 A1_Propeptide 19..45 CDD:462326 8/25 (32%)
pepsin_A 66..386 CDD:133145 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.