DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and pga4

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:384 Identity:154/384 - (40%)
Similarity:216/384 - (56%) Gaps:39/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLRVPLHKFQSARRHFADVGTELQQLRIRYGGGDV--------------------PEPLSNYMDA 71
            :::|||.|.:|.|       ..||:|.:.   ||.                    .|.|.||||.
 Frog    16 VVKVPLRKGESFR-------NRLQRLGLL---GDYLKKYPYNPASKYFPTLAQSSAEVLQNYMDI 70

  Fly    72 QYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQY 136
            :|||.|:||:|||.|.|:|||||:||||||..|  ::.||..||:::..:|.|:....|..:|||
 Frog    71 EYYGTISIGTPPQEFTVIFDTGSANLWVPSVYC--SSSACTNHNRFNPQQSTTFQATNTPVSIQY 133

  Fly   137 GSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYAM 201
            |:||:||:|..||:.:..:.|.:|.|..:.||||.....:.|||||||.:.||:..:..|.|..|
 Frog   134 GTGSMSGFLGYDTLQVGNIKISNQMFGLSESEPGSFLYYSPFDGILGLAFPSIASSQATPVFDNM 198

  Fly   202 YEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKMDAASI-GDL 265
            :.||||...:||.||:.|..|  |..::|||.|.::|:|...::|:|.:.||||.:|:.|| |.:
 Frog   199 WSQGLIPQNLFSVYLSSDGQS--GSYVLFGGVDTSYYSGSLNWVPLTAETYWQIILDSISINGQV 261

  Fly   266 QLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFE 330
            ..|...||.|.||||||:..|.....:|...||.:....||||::|:.|..:|.|.|.:.|..:.
 Frog   262 IACSQSCQAIVDTGTSLMTGPTTPIANIQYYIGASQDSNGQYVINCNNISNMPTIVFTINGVQYP 326

  Fly   331 LEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFA 389
            |....|: |..|.|   |.|||..:.:|..:|.|||||||||.:|:..||..|:.|..|
 Frog   327 LPPTAYV-RQNQQG---CSSGFQAMTLPTNSGDLWILGDVFIRQYFVVFDRTNNYVAMA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623 11/37 (30%)
pepsin_A 62..382 CDD:133145 143/328 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.