DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and napsa

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001005701.1 Gene:napsa / 448214 XenbaseID:XB-GENE-947098 Length:402 Species:Xenopus tropicalis


Alignment Length:375 Identity:214/375 - (57%)
Similarity:269/375 - (71%) Gaps:14/375 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLRVPLHKFQSARRHFADVGTELQQLRIRYGGG--------DVPEPLSNYMDAQYYGPIAIGSPP 83
            |:|:||.||.|.||..:|..|:.:     :.|.        .:||.|:||:||||||.|.||:||
 Frog    18 LIRIPLKKFPSIRRTLSDSMTKEE-----FNGATKEFLKQQTIPEKLTNYLDAQYYGEIFIGTPP 77

  Fly    84 QNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTD 148
            |.|.|:||||||||||||.||...:.||.:|.||.:..|.||.:|.||||||||:|||||:||.|
 Frog    78 QKFAVIFDTGSSNLWVPSIKCSFFDFACWLHKKYRSKDSSTYQQNNTEFAIQYGTGSLSGFLSQD 142

  Fly   149 TVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYAMYEQGLISAPVFS 213
            ||::..:|:.:||||||:.:||:|||.|.||||||:||.:||||.|.|.|..|.||.|:...|||
 Frog   143 TVTVGSIDVANQTFAEAVKQPGIVFVFAHFDGILGMGYPNISVDGVVPVFDNMMEQKLLEENVFS 207

  Fly   214 FYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKMDAASIGD-LQLCKGGCQVIAD 277
            |||:|||.:..|||::.||:|||:|||:|.||.|||.||||||.|...:.: |.|||||||.|.|
 Frog   208 FYLSRDPMAMVGGELVLGGTDPNYYTGDFHYLNVTRMAYWQIKADEVRVANQLVLCKGGCQAIVD 272

  Fly   278 TGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQ 342
            ||||||..|.||..::::.||..|:..|:|.|:|..|..||.:.|:|||..:.|.|:.|:|::::
 Frog   273 TGTSLITGPREEIRALHKAIGAFPLFSGEYFVNCKRIQSLPTVSFILGGVAYNLTGEQYVLKISK 337

  Fly   343 MGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADAK 392
            .|.|:||||||||||.||.||||||||||||:|||.||..|||||||.||
 Frog   338 FGHTLCLSGFMGLDIRPPAGPLWILGDVFIGQYYTVFDRDNDRVGFATAK 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
napsaNP_001005701.1 A1_Propeptide 18..42 CDD:369623 11/28 (39%)
pepsin_retropepsin_like 61..384 CDD:386101 195/322 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 437 1.000 Domainoid score I553
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 475 1.000 Inparanoid score I1451
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - otm47974
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X163
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.