DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and CG5863

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster


Alignment Length:379 Identity:166/379 - (43%)
Similarity:234/379 - (61%) Gaps:23/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLRVPLHKFQ-----SARRHFADVGTEL--------QQLRIRYGGGDVPEPLSNYMDAQYYGPIA 78
            |:|:|: :||     |.|:|.|...:.|        |::..|.||  ..|.|.|.::.:|.|||:
  Fly    25 LIRIPM-QFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTSRNGG--ATETLDNRLNLEYAGPIS 86

  Fly    79 IGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSG 143
            ||||.|.|.::|||||:||||||.:|...::||..|::|:||.|.|:..:|..|:|.||:|||||
  Fly    87 IGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPDGRRFSIAYGTGSLSG 151

  Fly   144 YLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYAMYEQGLIS 208
            .|:.|||:|..|.:::|||..|..|||..||...|.||:|||:..|:...:||.|.:|.:|.|:.
  Fly   152 RLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAELGIKPLFESMCDQQLVD 216

  Fly   209 APVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKMDAASIGDLQLCKGGCQ 273
            ..||||||.|:.:..:|||::|||.|...::|..||:|:|...|||..:|...:...::.:.. |
  Fly   217 ECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDVIEVAGTRINQNR-Q 280

  Fly   274 VIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYIL 338
            .||||||||:|||..|...||..:||.|....:|:::|..|..||.|.|::||:.|.|:.:||::
  Fly   281 AIADTGTSLLAAPPREYLIINSLLGGLPTSNNEYLLNCSEIDSLPEIVFIIGGQRFGLQPRDYVM 345

  Fly   339 RVA-QMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADA 391
            ... ..|.:||||.|..:|     ...|||||||||:|||.||.|..|:|||.|
  Fly   346 SATNDDGSSICLSAFTLMD-----AEFWILGDVFIGRYYTAFDAGQRRIGFAPA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 149/326 (46%)
Asp 80..394 CDD:278455 148/319 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455565
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - mtm978
orthoMCL 1 0.900 - - OOG6_100536
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.