DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and CG17283

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster


Alignment Length:369 Identity:151/369 - (40%)
Similarity:208/369 - (56%) Gaps:21/369 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VPLHKFQSARRHFADVGTELQQLRIRYG------GGDVPEPLSNYMDAQYYGPIAIGSPPQNFRV 88
            :||...|:..|...::.:|...|..|||      .|..  .|.|..:.:|...:.||:|.|.|.|
  Fly   103 LPLDFQQNFVRTTDNLRSEKAFLANRYGFSFAKSSGTA--TLKNTANMEYTCKMNIGTPKQKFTV 165

  Fly    89 VFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTDTVSIA 153
            :.||||||:|||...|  .:.||..|.:|..:||.||.|||..|||.|||||::|.|:.|||.||
  Fly   166 LPDTGSSNIWVPGPHC--KSKACKKHKQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIA 228

  Fly   154 GLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYAMYEQGLISAPVFSFYLNR 218
            ||.:.:||||....|||..||.:.|||||||||.||:||.||.....|..:.:|::..|:..:..
  Fly   229 GLVVTNQTFAMTTKEPGTTFVTSNFDGILGLGYRSIAVDNVKTLVQNMCSEDVITSCKFAICMKG 293

  Fly   219 DPASPEGGEIIFGGSDPNHYTG--EFTYLPVTRKAYWQIKMDAASIGDLQLCKGGCQVIADTGTS 281
            ..:|..||.||||.|:.:.|:|  .:||.|||:|.|||..:....:|..:: .|..|.|.|:|||
  Fly   294 GGSSSRGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVGGTKV-SGSVQAIVDSGTS 357

  Fly   282 LIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRV-AQMGK 345
            ||.||......||:.||......|:..:.|  ..::|...||:.||.|.::|....|:| ...|:
  Fly   358 LITAPTAIYNKINKVIGCRATSSGECWMKC--AKKIPDFTFVIAGKKFVVKGNKMKLKVRTNRGR 420

  Fly   346 TICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFA 389
            |:|:|....:    |:.|: ||||.||..:.||||:.|:|:|||
  Fly   421 TVCISAVTEV----PDEPV-ILGDAFIRHFCTEFDLANNRIGFA 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 139/326 (43%)
Asp 149..460 CDD:278455 139/321 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455570
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.