DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and ren

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_998025.1 Gene:ren / 405786 ZFINID:ZDB-GENE-040630-3 Length:395 Species:Danio rerio


Alignment Length:395 Identity:172/395 - (43%)
Similarity:238/395 - (60%) Gaps:18/395 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTE----LQQLRIRY-----GGGDVP 62
            ||:..|:|.       ....|.||.|.|..|.|....::...    |.::..:|     ..|..|
Zfish     8 LLILSLSAI-------STKALWRVKLKKMPSIRETLKEMSVTPAQVLSEIMPKYQEPSPTNGTAP 65

  Fly    63 EPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTK 127
            .||.||:|.||:|.|:||||.|.|.|||||||:||||||..|.....||..||:||||||.|:..
Zfish    66 TPLINYLDTQYFGEISIGSPAQMFNVVFDTGSANLWVPSHSCSPLYTACFTHNRYDASKSLTHIF 130

  Fly   128 NGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVD 192
            |||.|:|||.||::.|:||.|.|.:.|:.:. |.||||.:.|.:.|:.|||||:||:||.::::|
Zfish   131 NGTGFSIQYASGNVRGFLSEDVVVVGGIPVV-QVFAEATALPAIPFILAKFDGVLGMGYPNVAID 194

  Fly   193 KVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKM 257
            .:.|.|..:..|.::...|||.|.:|||....|||::.||:|||::||.|.|:....:..|::.|
Zfish   195 GITPVFDRIMSQHVLKENVFSVYYSRDPTHIPGGELVLGGTDPNYHTGPFHYINTKEQGKWEVIM 259

  Fly   258 DAASIG-DLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIK 321
            ...|:| |:..||.||..:.|||:|.|..|....:.:.:.||...:..|.|.|||:::..||.:.
Zfish   260 KGVSVGADILFCKDGCTAVIDTGSSYITGPASSISILMKTIGAVELAEGGYTVSCNVVRLLPTVA 324

  Fly   322 FVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRV 386
            |.|||:.:.|..:||||..::.|:.||...|..||:|||.||:||||..||.:||||||.||:|:
Zfish   325 FHLGGQEYSLTDEDYILWQSEFGEDICTVTFKALDVPPPTGPVWILGANFIARYYTEFDRGNNRI 389

  Fly   387 GFADA 391
            |||.|
Zfish   390 GFARA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
renNP_998025.1 A1_Propeptide 23..>38 CDD:285240 6/14 (43%)
renin_like 68..394 CDD:133154 155/326 (48%)
Asp 75..394 CDD:278455 151/319 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X163
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.