DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and CG31928

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001259869.1 Gene:CG31928 / 326175 FlyBaseID:FBgn0051928 Length:418 Species:Drosophila melanogaster


Alignment Length:418 Identity:150/418 - (35%)
Similarity:217/418 - (51%) Gaps:43/418 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VALLLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTELQQLRIR------------- 55
            :||.||.....|.:|..|:.....:::.||:..:..:..:....  |:||::             
  Fly     9 LALTLVLIWCLAQSHVESRRWRKSVQLKLHRETNHTKILSSFHN--QKLRLKEKLSPTSDLAISS 71

  Fly    56 ---YGGGDVPEPLSNYMDAQYYGPIAIGSP-PQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNK 116
               |......|.|.|..:.:||.....|:| .|...::.||.|:||.|.|.:  ....:||.|:.
  Fly    72 VSVYQTTVSKENLINSHNTEYYVTAGFGTPKSQPVTLLVDTASANLLVYSSE--FVKQSCLHHDG 134

  Fly   117 YDASKSKTYTKNGTEFAIQYGSGS-LSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDG 180
            |::|:|:||..||:.|.||:.|.. |:|.|||||.::..|.||:|||||..|.|..:...:.|||
  Fly   135 YNSSESQTYQANGSPFQIQFASQEILTGILSTDTFTLGDLVIKNQTFAEINSAPTDMCKRSNFDG 199

  Fly   181 ILGLGYNSISVDKVKPPFYAMYEQGLISAPVFSFYLNRDPA-SPEGGEIIFGGSDPNHYTGEFTY 244
            |:|||::.|:::.|:.|...:.|||||..|:||.|:||:.: :..||.::.|||||..|:|..||
  Fly   200 IIGLGFSEIALNGVETPLDNILEQGLIDEPIFSLYVNRNASDASNGGVLLLGGSDPTLYSGCLTY 264

  Fly   245 LPVTRKAYWQIKMDAASIGDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIG--GTPIIGGQY 307
            :||::..:|||.:....||..:|| ..||.|.|.|||||..|......||:|:|  .|....|.|
  Fly   265 VPVSKVGFWQITVGQVEIGSKKLC-SNCQAIFDMGTSLIIVPCPALKIINKKLGIKETDRKDGVY 328

  Fly   308 VVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGP--------- 363
            ::.|..:..||.|.|.:|.|.|.|...||||..:    ..|:|||..|.  ..||.         
  Fly   329 IIDCKKVSHLPKIVFNIGWKDFTLNPSDYILNYS----GTCVSGFSSLS--DCNGTQTNDDSEDL 387

  Fly   364 --LWILGDVFIGKYYTEFDMGNDRVGFA 389
              :|:.||||.|..:|.||.|...||.|
  Fly   388 NNIWVFGDVFFGAIFTLFDFGLKLVGMA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
CG31928NP_001259869.1 pepsin_retropepsin_like 84..416 CDD:299705 136/341 (40%)
Asp 91..416 CDD:278455 134/334 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455569
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.