DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and Bace2

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001002802.1 Gene:Bace2 / 288227 RGDID:1303241 Length:514 Species:Rattus norvegicus


Alignment Length:378 Identity:92/378 - (24%)
Similarity:150/378 - (39%) Gaps:101/378 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYG 137
            ||..:.||:|||..|::.||||||..|.... |     ..:...:|:..|.||...|.|..::|.
  Rat    88 YYLEMLIGTPPQKVRILVDTGSSNFAVAGAP-H-----SYIDTYFDSESSSTYHSKGFEVTVKYT 146

  Fly   138 SGSLSGYLSTDTVSIAG-------LDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVK 195
            .||.:|::..|.|:|..       ::|.....:|....||:     |::|||||.|.:::    |
  Rat   147 QGSWTGFVGEDLVTIPKGFNSSFLVNIATIFESENFFLPGI-----KWNGILGLAYAALA----K 202

  Fly   196 PP------FYAMYEQGLISAPVFSFY-----LNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTR 249
            |.      |.::..|..| ..:||..     |....:...||.::.||.:|:.|.|:..|.|:..
  Rat   203 PSSSLETFFDSLVAQAKI-PDIFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKE 266

  Fly   250 KAYWQIKMDAASIGDLQL---CK--GGCQVIADTGTSLIAAPLEEATSINQKIGGTPII------ 303
            :.|:||::....||...|   |:  ...:.|.|:||:|:..|.:...::.:.:..|.:|      
  Rat   267 EWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARTSLIPEFSDG 331

  Fly   304 ---GGQYVVSC-----------------------------DLIPQLPVIKFVLGGKTFELEGKDY 336
               |.|  ::|                             .::|||.:...:..|..:|      
  Rat   332 FWTGAQ--LACWTNSETPWAYFPKISIYLRDENASRSFRITILPQLYIQPMMGAGFNYE------ 388

  Fly   337 ILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFA 389
            ..|......|..|                ::|...:..:|..||....|||||
  Rat   389 CYRFGISSSTNAL----------------VIGATVMEGFYVVFDRAQRRVGFA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
Bace2NP_001002802.1 beta_secretase_like 85..446 CDD:133140 92/378 (24%)
Asp 88..425 CDD:278455 90/376 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.