DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and Cym

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001104613.1 Gene:Cym / 229697 MGIID:2684977 Length:379 Species:Mus musculus


Alignment Length:402 Identity:143/402 - (35%)
Similarity:217/402 - (53%) Gaps:35/402 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKVALLLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGT----------ELQQLRIR 55
            |::..|||.| ||.:.:|.       :.|:||||.:|.|....:.|.          |..:...|
Mouse     1 MRRFVLLLAA-LAISQSHV-------VTRIPLHKGKSLRNTLKEQGLLEDFLSRQQYEFSEKNSR 57

  Fly    56 YGGGDVPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDAS 120
            . |....|||.||:|::|:|.|.||:|||.|.||||||||.|||||..|:  :..|..|:::|.|
Mouse    58 I-GVVASEPLINYLDSEYFGTIYIGTPPQEFTVVFDTGSSELWVPSVYCN--SKVCRNHHRFDPS 119

  Fly   121 KSKTYTKNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLG 185
            ||.|:........:|||:|.:.|:|:.|||:::.:.:..||...:..|||.:|..:.|||||||.
Mouse   120 KSITFQNLSKPLFVQYGTGRMEGFLAYDTVTVSDIVVSHQTVGLSTQEPGDIFTYSPFDGILGLA 184

  Fly   186 YNSISVDKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRK 250
            |.:.:.....|.|..|..:.|::..:||.|::|   :.:|..:..|..|.:::.|...::|||.:
Mouse   185 YPTFASKYSVPIFDNMMNRHLVAQDLFSVYMSR---NEQGSMLTLGAIDQSYFIGSLHWVPVTVQ 246

  Fly   251 AYWQIKMDAASI-GDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLI 314
            .|||..:|..:| |::..|:|||..:.||||:|:..|..:..:|.|.||.......|:.:.|..:
Mouse   247 GYWQFTVDRITINGEVVACQGGCPAVLDTGTALLTGPGRDILNIQQVIGAVQGHNDQFDIDCWRL 311

  Fly   315 PQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEF 379
            ..:|.:.|.:.|:.|.|....|..:|    :..|.|||      .....:||||||||.::|:.|
Mouse   312 DIMPTVVFEIHGREFPLPPYAYTNQV----QGFCSSGF------KQGSHMWILGDVFIREFYSVF 366

  Fly   380 DMGNDRVGFADA 391
            |..|:|||.|.|
Mouse   367 DRANNRVGLAKA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
CymNP_001104613.1 A1_Propeptide 19..44 CDD:285240 8/24 (33%)
pepsin_retropepsin_like 64..377 CDD:299705 122/327 (37%)
Asp 73..378 CDD:278455 117/319 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.