DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and asp-8

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_503825.2 Gene:asp-8 / 178750 WormBaseID:WBGene00019105 Length:386 Species:Caenorhabditis elegans


Alignment Length:403 Identity:114/403 - (28%)
Similarity:178/403 - (44%) Gaps:41/403 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VALLLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTELQQLRIRYGGGDVPEPLSNY 68
            ::||.:..|.:|.....|.||.|.||..|  .:..|     .|.||.::: :...|:|  ...::
 Worm     6 ISLLGLVALCSAGQFSISVEKSGSLREQL--IREGR-----YGQELARIQ-QLSTGNV--SFFDH 60

  Fly    69 MDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMH-------NKYDASKSKTYT 126
            .|..|...:.||:|.|:|:|.|||.||||||...:|...|  |  |       .:|:.:.|.|:.
 Worm    61 FDEYYTAGVRIGTPAQHFQVAFDTTSSNLWVFGVECRSQN--C--HGGRGRRDREYNRTASSTFV 121

  Fly   127 KNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAK-----FDGILGLGY 186
            ...:.|.:.|..|.:||.:..||...||..|:.|.|       |:...|.:     |||:||||:
 Worm   122 AGTSSFNLPYDGGHVSGNVGKDTAQFAGFTIQSQDF-------GIGTAATRLFGETFDGVLGLGW 179

  Fly   187 NSISVDKVKPPFYAMYEQGLISAPVFSFYLNRDPA--SPEGGEIIFGGSDPNHYTGEFTYLPVTR 249
            .:.:::........:..|  :...:|:.|..:...  ...||:|:||..|..|...:..|:|:..
 Worm   180 PATALNGTSTTMQNLLPQ--LDQKLFTTYFTKSNMHNGTAGGDIMFGAIDTTHCQSQVNYVPLAY 242

  Fly   250 KAYWQIKMDAASIGDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQ-YVVSCDL 313
            .::|...:|..|||.....:.. ..|.||.:.....|......|.:..|.|.....| |.:.|..
 Worm   243 NSFWSYSVDGFSIGTYSRTQTE-TTIPDTSSGWTGVPNVVLAGIVKATGATYDWNHQAYTLPCSS 306

  Fly   314 IPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTE 378
            ...||.:.|.:||.::.:...:|::.: .:....|.....| .....:||.|||||.|:..|...
 Worm   307 TATLPDMVFTIGGNSYNVRAVEYVVNL-NLPNGQCALSLFG-TAASQSGPAWILGDNFLRSYCHV 369

  Fly   379 FDMGNDRVGFADA 391
            ||.||.|:|.|.|
 Worm   370 FDFGNSRIGLAKA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
asp-8NP_503825.2 pepsin_like 65..381 CDD:133138 94/331 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D270366at33208
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.