DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cathD and nots

DIOPT Version :9

Sequence 1:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_571879.1 Gene:nots / 114367 ZFINID:ZDB-GENE-010620-1 Length:416 Species:Danio rerio


Alignment Length:413 Identity:171/413 - (41%)
Similarity:237/413 - (57%) Gaps:34/413 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKVALLLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSAR---RHFADVGTELQQ-----LRIRY- 56
            |:...|:|:..|....:       .|||||.|.::.|.|   |..|.:...|:|     ...|| 
Zfish     1 MRSAGLILILVLHLGFS-------TGLLRVALRQYPSVRSRLRASAQLEEFLKQHQPDMFSRRYV 58

  Fly    57 -----------GGGDVPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIA 110
                       .|..|.|.|.|:||||::|.|::|.|.|||.||||||||:|||||..|  ...|
Zfish    59 QCFPPAQHFLRPGRRVTERLYNFMDAQFFGQISLGRPEQNFTVVFDTGSSDLWVPSSYC--VTQA 121

  Fly   111 CLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVA 175
            |.:|||:.|.:|.|||.:|..|.|.||||.|.|.::.|.:.:..:.:::|.|.||:.|||..||.
Zfish   122 CALHNKFKAFESSTYTHDGRVFGIHYGSGHLLGVMARDELKVGSVRVQNQVFGEAVYEPGFSFVL 186

  Fly   176 AKFDGILGLGYNSISVDKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTG 240
            |:|||:||||:..::.:|..|.|..|.||.::..|||||||..: .|..|||::||.:|.:.:..
Zfish   187 AQFDGVLGLGFPQLAEEKGSPVFDTMMEQNMLDQPVFSFYLTNN-GSGFGGELVFGANDESRFLP 250

  Fly   241 EFTYLPVTRKAYWQIKMDAASI-GDLQLCK---GGCQVIADTGTSLIAAPLEEATSINQKIGGTP 301
            ...::|||:|.|||||:||..: |.|....   .|||.|.|||||||..|..:...:.|.||.||
Zfish   251 PINWIPVTQKGYWQIKLDAVKVQGALSFSDRSVQGCQAIVDTGTSLIGGPARDILILQQFIGATP 315

  Fly   302 IIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWI 366
            ...|::||.|..:..|||:.|::....:.|.|:.|:.|.....|.||.|||..:::|.|.||:||
Zfish   316 TANGEFVVDCVRVSSLPVVSFLINSVEYSLSGEQYVRRETLNNKQICFSGFQSIEVPSPAGPVWI 380

  Fly   367 LGDVFIGKYYTEFDMGNDRVGFA 389
            |||||:.:.|:.:|.|.:|||.|
Zfish   381 LGDVFLSQVYSIYDRGENRVGLA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cathDNP_001334713.1 None
notsNP_571879.1 A1_Propeptide 20..48 CDD:285240 10/27 (37%)
Asp 85..403 CDD:278455 144/320 (45%)
pepsin_retropepsin_like 86..403 CDD:299705 143/319 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100536
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.