DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment deltaCOP and ret2

DIOPT Version :9

Sequence 1:NP_652012.1 Gene:deltaCOP / 45250 FlyBaseID:FBgn0028969 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_588336.1 Gene:ret2 / 2538953 PomBaseID:SPCC285.08 Length:240 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:97/248 - (39%)
Similarity:159/248 - (64%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLIAAAVCTKNGKVILSRQFVEMTKARIEGLLAAFPKLMTAGKQHTYVETDSVRYVYQPMEKLY 65
            ||::|.::..:.||.|:||||.||::.|:|.||::||.|::...|:|.||:|:||:||||:::||
pombe     1 MVVLAVSIVNRGGKAIISRQFREMSRVRVESLLSSFPALVSEKSQNTTVESDNVRFVYQPLDELY 65

  Fly    66 MLLITTKASNILEDLETLRLFSKVIPEYSHSLDEKEIVENAFNLIFAFDEIVALGYRESVNLAQI 130
            ::|||...||||:|::||.|.|:|:.....||:|:||:|.||.:..||||..:||||::|:|.||
pombe    66 IVLITNLQSNILQDIDTLHLLSQVVTSICSSLEEREILEYAFEIFTAFDEATSLGYRDNVSLTQI 130

  Fly   131 KTFVEMDSHEEKVYQAVRQTQERDARQKMREKAKELQRQRMEASKRGGPSLGGIGSRSGGFSADG 195
            ||::||:|||||:.:.|.:.:|.:|.::.:.:.|:|:.|:.||::|               :|..
pombe   131 KTYLEMESHEEKIQEIVSRNKEIEATEERKRRIKQLELQKKEAARR---------------AAQN 180

  Fly   196 IGSSGVSSSSGASSANTGITSIDVDTKS-------KAAASKPASRNALKLGGK 241
            :.|:....|.|..:.||...:.:|:.:|       .|.||.......::||.|
pombe   181 LPSADAYESIGYQTVNTTFATSNVEDESAMESYHAAAKASSAPKAKGMQLGKK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
deltaCOPNP_652012.1 AP_delta-COPI_MHD 292..529 CDD:271162
ret2NP_588336.1 Clat_adaptor_s 3..136 CDD:261170 65/132 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I1234
eggNOG 1 0.900 - - E1_KOG2635
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003612
OrthoInspector 1 1.000 - - oto101238
orthoMCL 1 0.900 - - OOG6_101729
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R228
SonicParanoid 1 1.000 - - X2487
TreeFam 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.