DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1beta and EFCC1

DIOPT Version :9

Sequence 1:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001364429.1 Gene:EFCC1 / 79825 HGNCID:25692 Length:599 Species:Homo sapiens


Alignment Length:241 Identity:51/241 - (21%)
Similarity:90/241 - (37%) Gaps:85/241 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RWYRHIASFEAAERAAWSGTPLPQLAGGKP------------------------TVAAAAKPAAD 94
            ||.|.:.:.....|:..|..|.||||..:|                        :.:::...|.|
Human   314 RWVRRLEAELQRYRSEDSQLPTPQLANPEPGDKSNEPEDAGTRDPDPTPEGAWQSDSSSGSRALD 378

  Fly    95 DDDDVDLFGS------DDEEDEEAERIKQERVAAYAAKKSKKPALIAKSSVLLDVKP----WDDE 149
            :..|..||.|      .|||:.|.||.::|:         |.||..|| ::|..:..    .||:
Human   379 EAVDEQLFRSVEGQAASDEEEVEEERWQEEK---------KTPAAEAK-TLLARLSSCRGRCDDQ 433

  Fly   150 TDMKEM--------ENNVRTI-EMDGLLWGASKLV-----------PVGYGINKLQI-------- 186
            |..|.|        .|:..|: |::..:   :.||           .:|....:.::        
Human   434 TAEKLMTYFGHFGGANHAHTLGELEACI---AMLVEQLRTQGCGGRTLGTSEEEAELQQKVEENE 495

  Fly   187 -----MCVIEDDKVSIDLLQEKIEEFEDFVQ-----SVDIAAFNKI 222
                 :.::|.::|.:.||:||:.:....:|     ::...|..||
Human   496 HLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISKRALGKI 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341 3/7 (43%)
EF1_GNE 139..222 CDD:279125 20/124 (16%)
EFCC1NP_001364429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CCD48 18..599 CDD:406280 51/241 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..127
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..198
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11595
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.