DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1beta and Efcc1

DIOPT Version :9

Sequence 1:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_006506501.1 Gene:Efcc1 / 58229 MGIID:3611451 Length:559 Species:Mus musculus


Alignment Length:208 Identity:38/208 - (18%)
Similarity:77/208 - (37%) Gaps:58/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TTPQGLKELNAFLADNSYISGYTPSKADLSVFDAL-GKAPSADNVNVARWYRHIASFEAAERAAW 70
            |||:|::..:         |..|....|..:|.:: |:|.|                |..|...|
Mouse   337 TTPEGVQRSD---------SRDTDEAEDEQLFRSVEGQAAS----------------EEEEEERW 376

  Fly    71 SGTP-LPQLAGGKPTVAAAAKPAADDDDDVDLFGSDDEEDEEAERIKQERVAAYAAKKSKKPALI 134
            ...| .||..|..|.|..:...:..||...:...:.....:.||.|....:..:..:..::    
Mouse   377 QEKPGRPQAHGEVPLVQPSGCVSRCDDQTAETLKASFGHCDGAEHICTLELETHVTRLGEQ---- 437

  Fly   135 AKSSVLLDVKPWDDETDMKEMENNVRTIEMDGLLWGASKLVPVGYGINKLQIMCVIEDDKVSIDL 199
                 |..:...::|.::::|      :|.:.|               :|::. ::|.::|.:.|
Mouse   438 -----LQTLGTPEEEAELQQM------VEAEHL---------------RLELQ-MVETERVRLSL 475

  Fly   200 LQEKIEEFEDFVQ 212
            |:||:.:....:|
Mouse   476 LEEKLVDVLQLLQ 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341 11/55 (20%)
EF1_GNE 139..222 CDD:279125 13/74 (18%)
Efcc1XP_006506501.1 CCD48 7..559 CDD:374123 38/208 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11595
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.