DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1beta and eef1d

DIOPT Version :9

Sequence 1:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_012820590.2 Gene:eef1d / 496939 XenbaseID:XB-GENE-958968 Length:709 Species:Xenopus tropicalis


Alignment Length:162 Identity:108/162 - (66%)
Similarity:130/162 - (80%) Gaps:5/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ERAAWSGTPLPQLAG-GKPTVAAAAK----PAADDDDDVDLFGSDDEEDEEAERIKQERVAAYAA 125
            |::|.|..|:...|. .|..|..|||    .|.|||||:||||||:|||.|||||::||:..||.
 Frog   548 EKSASSQPPIKVAAPVQKVQVTPAAKEENGTAEDDDDDIDLFGSDEEEDAEAERIREERLRQYAE 612

  Fly   126 KKSKKPALIAKSSVLLDVKPWDDETDMKEMENNVRTIEMDGLLWGASKLVPVGYGINKLQIMCVI 190
            ||:|||.:|||||:|||||||||||||.::|..|||::|||||||:||||||||||.||||.||:
 Frog   613 KKAKKPGVIAKSSILLDVKPWDDETDMAKLEECVRTVQMDGLLWGSSKLVPVGYGIKKLQIQCVV 677

  Fly   191 EDDKVSIDLLQEKIEEFEDFVQSVDIAAFNKI 222
            |||||..|:|:|:|.:|||:||||||||||||
 Frog   678 EDDKVGTDILEEEITKFEDYVQSVDIAAFNKI 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341
EF1_GNE 139..222 CDD:279125 62/82 (76%)
eef1dXP_012820590.2 EF1B 621..709 CDD:238181 67/87 (77%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4652
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.