DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1beta and eEF1delta

DIOPT Version :9

Sequence 1:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_609361.1 Gene:eEF1delta / 34363 FlyBaseID:FBgn0032198 Length:256 Species:Drosophila melanogaster


Alignment Length:142 Identity:100/142 - (70%)
Similarity:116/142 - (81%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KPTVAAAAKPAADDDDDVDLFGSD-DEEDEEAERIKQERVAAYAAKKSKKPALIAKSSVLLDVKP 145
            :|.|.|....|.|||||||||||| :|||.||.||::||:|||||||:||..:||||:::|||||
  Fly   115 EPEVEAKKPEANDDDDDVDLFGSDSEEEDGEAARIREERLAAYAAKKAKKVQIIAKSNIILDVKP 179

  Fly   146 WDDETDMKEMENNVRTIEMDGLLWGASKLVPVGYGINKLQIMCVIEDDKVSIDLLQEKIEEFEDF 210
            ||||||:|.||..:|.|..|||||||||.|||.:||.||.|.||:||||||||.|.|:||:.|||
  Fly   180 WDDETDLKVMETEIRKITQDGLLWGASKFVPVAFGIQKLSISCVVEDDKVSIDWLTEEIEKLEDF 244

  Fly   211 VQSVDIAAFNKI 222
            ||||||||||||
  Fly   245 VQSVDIAAFNKI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341
EF1_GNE 139..222 CDD:279125 60/82 (73%)
eEF1deltaNP_609361.1 EF-1_beta_acid 134..>156 CDD:287546 14/21 (67%)
EF1B 168..256 CDD:238181 64/87 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470084
Domainoid 1 1.000 121 1.000 Domainoid score I1858
eggNOG 1 0.900 - - E1_COG2092
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102478at50557
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 1 1.000 - - otm46563
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11595
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
98.850

Return to query results.
Submit another query.