DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1beta and eef1b2

DIOPT Version :9

Sequence 1:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_956243.1 Gene:eef1b2 / 335370 ZFINID:ZDB-GENE-030131-7310 Length:225 Species:Danio rerio


Alignment Length:226 Identity:147/226 - (65%)
Similarity:176/226 - (77%) Gaps:5/226 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFGDVTTPQGLKELNAFLADNSYISGYTPSKADLSVFDALGKAPSADNVNVARWYRHIASFEAA 65
            |.|||:.||.|||.||.||||.|||.||.||:||::|||||...||||..:..|||.||.||: .
Zfish     1 MGFGDLKTPAGLKVLNNFLADKSYIEGYVPSQADIAVFDALSGVPSADLCHALRWYNHIKSFQ-K 64

  Fly    66 ERAAWSGT--PLPQL--AGGKPTVAAAAKPAADDDDDVDLFGSDDEEDEEAERIKQERVAAYAAK 126
            |:.:..|.  ||.|.  ||.:.|.|||...|.:||||:||||||:||||||.:||:||:|||.||
Zfish    65 EKGSLPGVKKPLGQYGPAGVEDTTAAAPAAADEDDDDIDLFGSDEEEDEEAAKIKEERLAAYNAK 129

  Fly   127 KSKKPALIAKSSVLLDVKPWDDETDMKEMENNVRTIEMDGLLWGASKLVPVGYGINKLQIMCVIE 191
            |:||||||||||:|||||||||||||.::|..||:|::|||:||.|||:||||||.||||.||:|
Zfish   130 KAKKPALIAKSSILLDVKPWDDETDMAKLEECVRSIQLDGLVWGQSKLLPVGYGIKKLQIACVVE 194

  Fly   192 DDKVSIDLLQEKIEEFEDFVQSVDIAAFNKI 222
            ||||..|.|:|.|..|||:|||:|:||||||
Zfish   195 DDKVGTDQLEELITAFEDYVQSMDVAAFNKI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341 37/58 (64%)
EF1_GNE 139..222 CDD:279125 57/82 (70%)
eef1b2NP_956243.1 GST_C_eEF1b_like <3..62 CDD:198341 37/58 (64%)
EF1_GNE 142..225 CDD:279125 57/82 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2092
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1480
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11595
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.