DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1beta and EEF1D

DIOPT Version :9

Sequence 1:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001123525.3 Gene:EEF1D / 1936 HGNCID:3211 Length:647 Species:Homo sapiens


Alignment Length:152 Identity:100/152 - (65%)
Similarity:126/152 - (82%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TPLPQLAGGKPTVAAAAKPAADD-DDDVDLFGSD-DEEDEEAERIKQERVAAYAAKKSKKPALIA 135
            :|:.|:   :|.....|.||.|| |||:|||||| :|||:||.::::||:..||.||:|||||:|
Human   499 SPMRQV---EPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVA 560

  Fly   136 KSSVLLDVKPWDDETDMKEMENNVRTIEMDGLLWGASKLVPVGYGINKLQIMCVIEDDKVSIDLL 200
            |||:|||||||||||||.::|..||:|::|||:|||||||||||||.||||.||:|||||..|||
Human   561 KSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLL 625

  Fly   201 QEKIEEFEDFVQSVDIAAFNKI 222
            :|:|.:||:.||||||||||||
Human   626 EEEITKFEEHVQSVDIAAFNKI 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341
EF1_GNE 139..222 CDD:279125 61/82 (74%)
EEF1DNP_001123525.3 EF-1_beta_acid 525..552 CDD:371151 14/26 (54%)
EF1_GNE 564..647 CDD:376378 61/82 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159540
Domainoid 1 1.000 137 1.000 Domainoid score I4899
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.