DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1beta and eef-1B.2

DIOPT Version :9

Sequence 1:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001122811.1 Gene:eef-1B.2 / 178419 WormBaseID:WBGene00012768 Length:440 Species:Caenorhabditis elegans


Alignment Length:65 Identity:18/65 - (27%)
Similarity:30/65 - (46%) Gaps:11/65 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GGKPTVAAA---AKPAADDDDDVDLFGSDDEEDEEAERIKQERVAAYAAKKSKKPALIAKSSVLL 141
            |||..:..|   ||.|||.       ..:.|..|:..::::|. :|.|.|.....:|:|:..:.|
 Worm    51 GGKSELKGAIHNAKHAADK-------ALNKEGGEDVSKLREEH-SALAKKVDDLASLVAELQLQL 107

  Fly   142  141
             Worm   108  107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341
EF1_GNE 139..222 CDD:279125 1/3 (33%)
eef-1B.2NP_001122811.1 DUF2431 122..294 CDD:287341
Asp_Glu_race <388..439 CDD:294351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I3353
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I2174
Isobase 1 0.950 - 0 Normalized mean entropy S637
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1464823at2759
OrthoFinder 1 1.000 - - FOG0001111
OrthoInspector 1 1.000 - - otm40246
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11595
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X680
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.020

Return to query results.
Submit another query.