powered by:
Protein Alignment eEF1beta and eef-1B.2
DIOPT Version :9
Sequence 1: | NP_001286506.1 |
Gene: | eEF1beta / 45249 |
FlyBaseID: | FBgn0028737 |
Length: | 222 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122811.1 |
Gene: | eef-1B.2 / 178419 |
WormBaseID: | WBGene00012768 |
Length: | 440 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 18/65 - (27%) |
Similarity: | 30/65 - (46%) |
Gaps: | 11/65 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 GGKPTVAAA---AKPAADDDDDVDLFGSDDEEDEEAERIKQERVAAYAAKKSKKPALIAKSSVLL 141
|||..:..| ||.|||. ..:.|..|:..::::|. :|.|.|.....:|:|:..:.|
Worm 51 GGKSELKGAIHNAKHAADK-------ALNKEGGEDVSKLREEH-SALAKKVDDLASLVAELQLQL 107
Fly 142 141
Worm 108 107
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
126 |
1.000 |
Domainoid score |
I3353 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
232 |
1.000 |
Inparanoid score |
I2174 |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S637 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1464823at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001111 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm40246 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11595 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X680 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
11 | 11.020 |
|
Return to query results.
Submit another query.