DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1beta and efcc1

DIOPT Version :9

Sequence 1:NP_001286506.1 Gene:eEF1beta / 45249 FlyBaseID:FBgn0028737 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_002663835.3 Gene:efcc1 / 100333996 ZFINID:ZDB-GENE-120813-3 Length:641 Species:Danio rerio


Alignment Length:193 Identity:34/193 - (17%)
Similarity:76/193 - (39%) Gaps:53/193 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GKAPSADNVNVARWYRHI----ASFEAAERAAWSGTPLPQLAGGKPTVAAAAKPAADDDDD---- 98
            |:|.:..:....:.:|.:    ||.|..||  |:|....|:...| .:........|..|:    
Zfish   411 GRAETVSDTMEEQLFRSVEGQAASDEEEER--WTGEQQRQVDEVK-RILTRLSCCGDRCDEKAVK 472

  Fly    99 --VDLFG-SDDEEDEEA-----ERI----KQERVAAYAAKKSKKPALIAKSSVLLDVKPWDDETD 151
              :..|| |..||.:.|     |::    ||..:....|::::......:.:::.:::...:||:
Zfish   473 KLLSHFGDSRTEESQTAVLELLEKVTRLNKQLELKESQARRAEMDTDQMRDALVQELQQKAEETE 537

  Fly   152 MKEMENNVRTIEMDGLLWGASKLVPVGYGINKLQIMCVIEDDKVSIDLLQEKIEEFEDFVQSV 214
            :..:|                           ||   ::|.::|.:.|:::|:.:....:|.:
Zfish   538 LLHLE---------------------------LQ---MLETERVRLSLVEDKLMDVLQLLQQL 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1betaNP_001286506.1 GST_C_eEF1b_like <3..62 CDD:198341 4/23 (17%)
EF1_GNE 139..222 CDD:279125 10/76 (13%)
efcc1XP_002663835.3 CCD48 8..641 CDD:292427 34/193 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11595
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.