DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nckx30C and LOC571043

DIOPT Version :9

Sequence 1:NP_652011.3 Gene:Nckx30C / 45248 FlyBaseID:FBgn0028704 Length:881 Species:Drosophila melanogaster
Sequence 2:XP_699687.6 Gene:LOC571043 / 571043 -ID:- Length:385 Species:Danio rerio


Alignment Length:363 Identity:165/363 - (45%)
Similarity:209/363 - (57%) Gaps:79/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 EQDPELNSNAVPGSDEDNAGNQRGINDTHN--DNSTTTKTPL--------------FPKDLFTKE 326
            ||..||.|:|          ..|.:..||.  .::.:..||:              :|.|||:.|
Zfish    43 EQWEELQSHA----------PHRTLLSTHQGYHSNVSEDTPIAMRSSAGSNESQGDYPTDLFSLE 97

  Fly   327 QLENGAVILHIIGVIYMFVALAIVCDEFFVPSLDVIIEKLGITDDVAGATFMAAGGSAPELFTSV 391
            ....|||:||:.|::|||:||||||||||||:|.||.|||.|:||||||||||||||||||||||
Zfish    98 DRRRGAVLLHMFGMLYMFIALAIVCDEFFVPALTVITEKLTISDDVAGATFMAAGGSAPELFTSV 162

  Fly   392 IGVFVSFDDVGIGTIVGSAVFNILFVIGMCALFSKTVLSLTWWPLFRDCSFYSISLLVLIYFFRD 456
            ||||:|..:||||||||||||||||||||||||||.:|:|||||||||.|||.|.|::||.||.|
Zfish   163 IGVFISHSNVGIGTIVGSAVFNILFVIGMCALFSKEILNLTWWPLFRDVSFYIIGLIMLIVFFLD 227

  Fly   457 NRIFWWEALILFTIYIGYVAFMKWNVQVETCVKKMITKNKVTRVRSTDQLMPAGNAANSSETSMA 521
            |.|.:.|::.|...|..||.|||:|..|||.||:|:.:|:|..|.:..:|.|:           |
Zfish   228 NIITYCESISLLLAYAAYVLFMKFNGNVETLVKRMMNRNQVVEVEAQPKLSPS-----------A 281

  Fly   522 TQPGGSVTSRAASETRSGPPGSSNAGATGNSSGGGGTSGSTQTGAKFRHGLLQLMIHTIDPL--- 583
            .:....:::|...:.                   ||:|.|.. .:..|:.:.||||||:|||   
Zfish   282 VEDDSKLSARPRLQR-------------------GGSSASLH-NSLMRNSIFQLMIHTLDPLSEE 326

  Fly   584 -------------------HDGKVDEKATQLHAIASLK 602
                               .:||..|||:.||.||..|
Zfish   327 FADSELGTYGKLKYYQSMTEEGKFREKASILHKIAKKK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nckx30CNP_652011.3 Na_Ca_ex 336..480 CDD:279963 106/143 (74%)
Na_Ca_ex 721..871 CDD:279963
LOC571043XP_699687.6 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1168500at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.