DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nckx30C and LOC100332770

DIOPT Version :9

Sequence 1:NP_652011.3 Gene:Nckx30C / 45248 FlyBaseID:FBgn0028704 Length:881 Species:Drosophila melanogaster
Sequence 2:XP_017212655.1 Gene:LOC100332770 / 100332770 -ID:- Length:145 Species:Danio rerio


Alignment Length:142 Identity:94/142 - (66%)
Similarity:115/142 - (80%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   740 MVWWANVAGDTARIPPEVMGLTFLAAGTSIPDLITSVIVARKGFGDMAVSSSVGSNIFDVTVGLP 804
            |||||:..|:|..|..|:||||.||||||||||||||||||||.|||||||||||||||:|||||
Zfish     1 MVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLP 65

  Fly   805 IPWLLYGIIYG-APVEVNSVGMVCSITILFMMLVFVVMSIACFRWRMNKGLGFTMFLLYFAFVAV 868
            .||||:.::.| .||:|:|.|:.|:|.:||:||:||::|||..:|||:|.|||.|||||..|:.|
Zfish    66 FPWLLFSMVNGMVPVQVSSNGLFCAIVLLFLMLLFVIVSIAACKWRMSKLLGFIMFLLYIVFLVV 130

  Fly   869 SLMFEYDVITCP 880
            |::.|..||.||
Zfish   131 SVLLEDKVIACP 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nckx30CNP_652011.3 Na_Ca_ex 336..480 CDD:279963
Na_Ca_ex 721..871 CDD:279963 89/131 (68%)
LOC100332770XP_017212655.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1168500at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.