DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-1 and VMA11

DIOPT Version :9

Sequence 1:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_015090.1 Gene:VMA11 / 855842 SGDID:S000006155 Length:164 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:51/170 - (30%)
Similarity:85/170 - (50%) Gaps:23/170 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SSNPY------MWACLGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVA 103
            :||.|      .:...|...::.||.:|||:|...:|..|.|.|...|.:..|:||.|:....:|
Yeast     6 ASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVMSGILA 70

  Fly   104 IYGLITAIVLSGQL---EQFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGS 165
            ||||:.|::::|.|   |.:::              |:|::....||.||...|..|.|:|:||.
Yeast    71 IYGLVVAVLIAGNLSPTEDYTL--------------FNGFMHLSCGLCVGFACLSSGYAIGMVGD 121

  Fly   166 GAALSDAANAALFVKILIVEIFGSAIGLFGLIVGIYMTSK 205
            ...........|||.|:::.||...:||:|:||.:.:.::
Yeast   122 VGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 22/61 (36%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 22/63 (35%)
VMA11NP_015090.1 ATP-synt_C 17..124 CDD:412393 37/120 (31%)
ATP-synt_Vo_c_ATP6C_rpt2 92..159 CDD:349416 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.