DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-1 and AT4G32530

DIOPT Version :9

Sequence 1:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001119099.1 Gene:AT4G32530 / 829388 AraportID:AT4G32530 Length:210 Species:Arabidopsis thaliana


Alignment Length:203 Identity:89/203 - (43%)
Similarity:124/203 - (61%) Gaps:35/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GERVSVGWFLASSNPYMWACLGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIF 98
            |...|.|..|...:||.::.:||.:|:.:||:|||.||:.||:|::|..::||||.:||||||||
plant     8 GHASSWGAALVRISPYTFSAIGIAISIGVSVLGAAWGIYITGSSLIGAAIEAPRITSKNLISVIF 72

  Fly    99 CEAVAIYGLITAIVLSGQLEQFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCG------ 157
            ||||||||:|.||:|..:||...........:::     :||.||.:|:.||..||.||      
plant    73 CEAVAIYGVIVAIILQTKLESVPSSKMYDAESLR-----AGYAIFASGIIVGFANLVCGSVSTLF 132

  Fly   158 ------------------------IAVGIVGSGAALSDAANAALFVKILIVEIFGSAIGLFGLIV 198
                                    :.|||:||..|||||.|:.||||||::||||||:||||:||
plant   133 SFLTVLVFGFHCQICNRGPHFSCRLCVGIIGSSCALSDAQNSTLFVKILVIEIFGSALGLFGVIV 197

  Fly   199 GIYMTSKS 206
            ||.|::::
plant   198 GIIMSAQA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 37/61 (61%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 42/93 (45%)
AT4G32530NP_001119099.1 ATP-synt_C 26..87 CDD:278563 37/60 (62%)
ATP-synt_C <157..202 CDD:278563 31/44 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2742
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2986
Inparanoid 1 1.050 178 1.000 Inparanoid score I1468
OMA 1 1.010 - - QHG53850
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 1 1.000 - - mtm1161
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.