DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-1 and AT2G25610

DIOPT Version :9

Sequence 1:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001325190.1 Gene:AT2G25610 / 817101 AraportID:AT2G25610 Length:227 Species:Arabidopsis thaliana


Alignment Length:169 Identity:88/169 - (52%)
Similarity:123/169 - (72%) Gaps:5/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SVGWFLASSNPYMWACLGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAV 102
            |.|..|...:||.::.:||.:|:.:||:|||.||:.||:|::|..::||||.:||||||||||||
plant    59 SWGAALVRISPYTFSAIGIAISIGVSVLGAAWGIYITGSSLIGAAIEAPRITSKNLISVIFCEAV 123

  Fly   103 AIYGLITAIVLSGQLEQFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGA 167
            ||||:|.||:|..:||...........:::     :||.||.:|:.||..||.||:.|||:||..
plant   124 AIYGVIVAIILQTKLESVPSSKMYDAESLR-----AGYAIFASGIIVGFANLVCGLCVGIIGSSC 183

  Fly   168 ALSDAANAALFVKILIVEIFGSAIGLFGLIVGIYMTSKS 206
            |||||.|:.||||||::||||||:||||:||||.|::::
plant   184 ALSDAQNSTLFVKILVIEIFGSALGLFGVIVGIIMSAQA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 37/61 (61%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 42/63 (67%)
AT2G25610NP_001325190.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2742
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2986
Inparanoid 1 1.050 178 1.000 Inparanoid score I1468
OMA 1 1.010 - - QHG53850
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 1 1.000 - - mtm1161
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.