DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-1 and ATP6V0B

DIOPT Version :9

Sequence 1:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001281262.1 Gene:ATP6V0B / 533 HGNCID:861 Length:261 Species:Homo sapiens


Alignment Length:183 Identity:119/183 - (65%)
Similarity:143/183 - (78%) Gaps:7/183 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LAVATILTLYFVMTGKGERVSVGWFLASSNPYMWACLGIGLSVSLSVVGAALGIHTTGTSIVGGG 82
            |||....|::.:    |.|..|.|||..::|:||:.|||||::||||||||.||:.||:||:|||
Human    20 LAVGVCYTIFDL----GFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGG 80

  Fly    83 VKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGQLEQFSMETALSQAAIQNTNWFSGYLIFGAGL 147
            |||||||||||:|:||||||||||:|.|||:|...|.||   |....||.:.|:.:||.:|||||
Human    81 VKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFS---ATDPKAIGHRNYHAGYSMFGAGL 142

  Fly   148 AVGLVNLFCGIAVGIVGSGAALSDAANAALFVKILIVEIFGSAIGLFGLIVGI 200
            .|||.|||||:.||||||||||:||.|.:|||||||||||||||||||:||.|
Human   143 TVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 48/61 (79%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 50/63 (79%)
ATP6V0BNP_001281262.1 PRK08344 48..199 CDD:236246 108/151 (72%)
ATP-synt_C 52..112 CDD:278563 48/59 (81%)
ATP-synt_C 136..196 CDD:278563 48/60 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143520
Domainoid 1 1.000 100 1.000 Domainoid score I7052
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2986
Inparanoid 1 1.050 239 1.000 Inparanoid score I3363
Isobase 1 0.950 - 0 Normalized mean entropy S432
OMA 1 1.010 - - QHG53850
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 1 1.000 - - oto90443
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - LDO PTHR10263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1637
SonicParanoid 1 1.000 - - X2155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.