DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-1 and ATP5MC3

DIOPT Version :9

Sequence 1:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001002258.1 Gene:ATP5MC3 / 518 HGNCID:843 Length:142 Species:Homo sapiens


Alignment Length:162 Identity:38/162 - (23%)
Similarity:56/162 - (34%) Gaps:41/162 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MWACLGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLS 114
            |:||..:..:.||...|:.:.......|:    :..|........|.:|      .|....:   
Human     1 MFACAKLACTPSLIRAGSRVAYRPISASV----LSRPEASRTGEGSTVF------NGAQNGV--- 52

  Fly   115 GQLEQFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSD-------- 171
            .||.|...:|:.....|.....|     .|||.|          .||:.||||.:..        
Human    53 SQLIQREFQTSAISRDIDTAAKF-----IGAGAA----------TVGVAGSGAGIGTVFGSLIIG 102

  Fly   172 -AANAALFVKILIVEIFG----SAIGLFGLIV 198
             |.|.:|..::....|.|    .|:|||.|:|
Human   103 YARNPSLKQQLFSYAILGFALSEAMGLFCLMV 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 10/61 (16%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 21/74 (28%)
ATP5MC3NP_001002258.1 ATP9 68..142 CDD:164765 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.