DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-1 and atp6v0cb

DIOPT Version :9

Sequence 1:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_991117.1 Gene:atp6v0cb / 325402 ZFINID:ZDB-GENE-030131-4127 Length:153 Species:Danio rerio


Alignment Length:166 Identity:51/166 - (30%)
Similarity:85/166 - (51%) Gaps:16/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LASSNPY---MWACLGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAI 104
            ::|.:|.   .:|.:|...::..|.:|||.|...:||.|....|..|.:..|::|.|:....:||
Zfish     1 MSSGSPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 65

  Fly   105 YGLITAIVLSGQLEQFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAAL 169
            |||:.|::::..:.             .....:..:|..||||:|||..|..|.|:||||.....
Zfish    66 YGLVVAVLIANSIS-------------DKITLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVR 117

  Fly   170 SDAANAALFVKILIVEIFGSAIGLFGLIVGIYMTSK 205
            ..|....|||.::::.||...:||:||||.:.:::|
Zfish   118 GTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 21/61 (34%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 27/63 (43%)
atp6v0cbNP_991117.1 V_ATP_synt_C 11..116 CDD:130170 36/117 (31%)
ATP-synt_Vo_c_ATP6C_rpt2 84..151 CDD:349416 27/66 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.