DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-1 and Vha16-3

DIOPT Version :9

Sequence 1:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster


Alignment Length:158 Identity:50/158 - (31%)
Similarity:83/158 - (52%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YMWACLGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVL 113
            :.:..:|...::..|.:|||.|...:||.|....|..|.:..|::|.|:....:|||||:.::::
  Fly    15 FFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGLVVSVLI 79

  Fly   114 SGQL-EQFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANAAL 177
            :|.| :.:::.              .||:...|||:||...|..|.|:||||.......|....|
  Fly    80 AGSLSDSYTIR--------------KGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRL 130

  Fly   178 FVKILIVEIFGSAIGLFGLIVGIYMTSK 205
            ||.::::.||...:||:||||.||:.:|
  Fly   131 FVGMILILIFAEVLGLYGLIVAIYLYTK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 19/61 (31%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 27/63 (43%)
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 35/118 (30%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 28/64 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453377
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.