DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma30A and BAALC

DIOPT Version :10

Sequence 1:NP_001285776.1 Gene:Ggamma30A / 45234 FlyBaseID:FBgn0267252 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001351803.1 Gene:BAALC / 79870 HGNCID:14333 Length:180 Species:Homo sapiens


Alignment Length:36 Identity:12/36 - (33%)
Similarity:14/36 - (38%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TTATGTENNPYTFEAQPQHHQQLDTPSQCSSQVLGQ 142
            :||.|...||   |.:.....|...|...||..|.|
Human   103 STAPGGIPNP---EKKTNCETQCPNPQSLSSGPLTQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma30ANP_001285776.1 GGL 11..67 CDD:238024
BAALCNP_001351803.1 BAALC_N 1..50 CDD:369161
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.