DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma30A and gng13b

DIOPT Version :9

Sequence 1:NP_001285776.1 Gene:Ggamma30A / 45234 FlyBaseID:FBgn0267252 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001002400.1 Gene:gng13b / 436673 ZFINID:ZDB-GENE-040718-97 Length:67 Species:Danio rerio


Alignment Length:67 Identity:28/67 - (41%)
Similarity:44/67 - (65%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LQNMDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAEKGKCV 70
            :..||...:||::|::|||.:.:|...||::.::..:|||....||.:|....|||||.||||||
Zfish     1 MDEMDLPQMKKEVESLKYQLAFKREKSSKTVTDLVKWIEECVPEDPFLNPELMKNNPWVEKGKCV 65

  Fly    71 IM 72
            ::
Zfish    66 LL 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma30ANP_001285776.1 GGL 11..67 CDD:238024 21/55 (38%)
gng13bNP_001002400.1 GGL 6..62 CDD:238024 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10247
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5346
OMA 1 1.010 - - QHG49271
OrthoDB 1 1.010 - - D1597581at2759
OrthoFinder 1 1.000 - - FOG0006416
OrthoInspector 1 1.000 - - otm25620
orthoMCL 1 0.900 - - OOG6_110441
Panther 1 1.100 - - LDO PTHR15936
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4582
SonicParanoid 1 1.000 - - X4681
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.