powered by:
Protein Alignment Ggamma30A and gng5
DIOPT Version :9
Sequence 1: | NP_001285776.1 |
Gene: | Ggamma30A / 45234 |
FlyBaseID: | FBgn0267252 |
Length: | 238 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_999886.1 |
Gene: | gng5 / 337838 |
ZFINID: | ZDB-GENE-030131-9966 |
Length: | 68 |
Species: | Danio rerio |
Alignment Length: | 57 |
Identity: | 16/57 - (28%) |
Similarity: | 35/57 - (61%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 ALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAEKGKC 69
|:||.::.::::|::.|..:|::.||::.|..:|..:|||:.......||:..:..|
Zfish 9 AMKKVVQQLRFEANINRVKVSQAAAELQQFCIQNAVHDPLLTGVSSSTNPFRTQKVC 65
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma30A | NP_001285776.1 |
GGL |
11..67 |
CDD:238024 |
15/53 (28%) |
gng5 | NP_999886.1 |
GGL |
9..63 |
CDD:238024 |
15/53 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.