powered by:
Protein Alignment Ggamma30A and GNGT1
DIOPT Version :9
Sequence 1: | NP_001285776.1 |
Gene: | Ggamma30A / 45234 |
FlyBaseID: | FBgn0267252 |
Length: | 238 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001316355.1 |
Gene: | GNGT1 / 2792 |
HGNCID: | 4411 |
Length: | 74 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 23/63 - (36%) |
Similarity: | 39/63 - (61%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 DRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAE-KGKCVI 71
::|.||.:::.:|.:.::||..:||...|:|.::||....|||:....:..||:.| ||.|||
Human 11 EKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVI 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ggamma30A | NP_001285776.1 |
GGL |
11..67 |
CDD:238024 |
18/56 (32%) |
GNGT1 | NP_001316355.1 |
GGL |
12..74 |
CDD:128520 |
23/62 (37%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.