DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma30A and gpc-2

DIOPT Version :9

Sequence 1:NP_001285776.1 Gene:Ggamma30A / 45234 FlyBaseID:FBgn0267252 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_491935.1 Gene:gpc-2 / 172396 WormBaseID:WBGene00001682 Length:62 Species:Caenorhabditis elegans


Alignment Length:64 Identity:28/64 - (43%)
Similarity:45/64 - (70%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAEKGKCVIM 72
            ||:..:::.:::::.|.::||.|::.|.||:|.|.|..|  |||:|..|||.||||||.||.::
 Worm     1 MDKSDMQRTVDSLRSQLNIERTPITVSAAELRRFTESQE--DPLVNPIDKKVNPWAEKSKCSML 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma30ANP_001285776.1 GGL 11..67 CDD:238024 23/55 (42%)
gpc-2NP_491935.1 GGL 3..62 CDD:128520 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I7125
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I3975
Isobase 1 0.950 - 0 Normalized mean entropy S3677
OMA 1 1.010 - - QHG49271
OrthoDB 1 1.010 - - D1597581at2759
OrthoFinder 1 1.000 - - FOG0006416
OrthoInspector 1 1.000 - - oto20394
orthoMCL 1 0.900 - - OOG6_110441
Panther 1 1.100 - - LDO PTHR15936
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4582
SonicParanoid 1 1.000 - - X4681
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.960

Return to query results.
Submit another query.