DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma30A and GNG14

DIOPT Version :9

Sequence 1:NP_001285776.1 Gene:Ggamma30A / 45234 FlyBaseID:FBgn0267252 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001303621.1 Gene:GNG14 / 105372280 HGNCID:53439 Length:107 Species:Homo sapiens


Alignment Length:39 Identity:12/39 - (30%)
Similarity:17/39 - (43%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KSIAEMRSFIEENEKNDPLINAPDKKNNPWAEKGKCVIM 72
            |..|::..|..|..||||.:.......|.:.||....|:
Human    69 KMAADLLKFCTEQAKNDPFLVGIPAATNSFKEKKPYAIL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma30ANP_001285776.1 GGL 11..67 CDD:238024 10/32 (31%)
GNG14NP_001303621.1 GGL 18..103 CDD:294053 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.