DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ggamma30A and si:dkey-204f11.64

DIOPT Version :9

Sequence 1:NP_001285776.1 Gene:Ggamma30A / 45234 FlyBaseID:FBgn0267252 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001275570.1 Gene:si:dkey-204f11.64 / 100537752 ZFINID:ZDB-GENE-030131-8332 Length:70 Species:Danio rerio


Alignment Length:60 Identity:16/60 - (26%)
Similarity:36/60 - (60%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAEKGKCVIM 72
            :|:|.:..::::||.:|..:|::..::::|..:|...||||......:||:.....||::
Zfish    11 SLQKSVNQLRFEASFDRIMVSQAADDLKAFCLKNASKDPLIKGVPPNDNPFRPAKSCVLL 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ggamma30ANP_001285776.1 GGL 11..67 CDD:238024 14/53 (26%)
si:dkey-204f11.64NP_001275570.1 GGL 9..70 CDD:128520 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.