DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment capt and CAP1

DIOPT Version :9

Sequence 1:NP_001033870.1 Gene:capt / 45233 FlyBaseID:FBgn0261458 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001099000.2 Gene:CAP1 / 10487 HGNCID:20040 Length:475 Species:Homo sapiens


Alignment Length:507 Identity:233/507 - (45%)
Similarity:316/507 - (62%) Gaps:56/507 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 LESICERLETLVDRLERTLTAPQPIELPTPTLPPPPAEEEEALPVFEKAETPPPPPSPPSSNMSV 362
            ::::.||||..|.|||..        ..|..:....|:.                ||...:...|
Human     4 MQNLVERLERAVGRLEAV--------SHTSDMHRGYADS----------------PSKAGAAPYV 44

  Fly   363 AGFEDIVAGPLSQYLTLSAKIGGDVAQHAELVKSAFGSQLQYVTLATQIAQPAQPKQAELLKPTS 427
            ..|:.::|||:::||.:|.:|||||.:|||:|.:....:...:..|:|..|||:.|.::||.|.|
Human    45 QAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPIS 109

  Fly   428 TQISAIQDFREKHRSSPFFNHLSAISESIPALGWVCVEKTPGPYVKEMNDAGQFYTNRVLKEWKE 492
            .||..:..||||:|.|..||||||:||||.|||||.:...|||||||||||..|||||||||:|:
Human   110 EQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKD 174

  Fly   493 KDVTHVEWARAWVQTLTELQAYIRQYHTTGLVWSGKG----------AAP-AGGAPPPPPPGGLP 546
            .|..||:|.:|::...|||||||:::|||||.||..|          :.| ||..||||||  .|
Human   175 VDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPP--CP 237

  Fly   547 PPPPMLDLSALKLDSAGDDRSALFAQINQGADITKGLKKVTGDMQTHKNPSL-------RTGPAP 604
            ||||:..:|. ..:||  .||:||||||||..||..||.|:.||:|||||:|       |:||.|
Human   238 PPPPVSTISC-SYESA--SRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKP 299

  Fly   605 FKSPAQSGGSKAVAAPSAAQA--KAP-VFERDGKKWIIEYQKNNTGLLVENAEMNNVVYVFKCEG 666
            |.:|      |...:||..:|  |.| |.|.:||||.:|.|:|.:.|::|:.|:..|.|::||..
Human   300 FSAP------KPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVN 358

  Fly   667 STLTVKGKVNNIVFDSCKKCSLLFDSVVASVEFVNCQSVQMQVLGSVPTVSIDKTDGCQMYLSKD 731
            :||.:|||:|:|..|:|||..|:||.||..||.:|.:.|::||:|.|||:||:|||||..||||:
Human   359 TTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKN 423

  Fly   732 SLGVEIVNSKSSEMNILLPDDSGDYTELALPEQYKTTIAGKTLKTVCVDSLG 783
            ||..|||::||||||:|:|.:.||:.|..:|||:||...|:.|.|...:..|
Human   424 SLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
captNP_001033870.1 CAP_N 299..604 CDD:279545 146/322 (45%)
CAP_C 633..781 CDD:285769 75/147 (51%)
CARP 664..701 CDD:197827 19/36 (53%)
CARP 702..739 CDD:197827 22/36 (61%)
CAP1NP_001099000.2 CAP_N 5..62 CDD:395969 19/80 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..237 9/22 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..319 18/46 (39%)
CAP_C 319..473 CDD:400772 78/153 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157045
Domainoid 1 1.000 256 1.000 Domainoid score I2044
eggNOG 1 0.900 - - E1_KOG2675
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H74572
Inparanoid 1 1.050 427 1.000 Inparanoid score I1748
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1098760at2759
OrthoFinder 1 1.000 - - FOG0001959
OrthoInspector 1 1.000 - - otm42204
orthoMCL 1 0.900 - - OOG6_101374
Panther 1 1.100 - - O PTHR10652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R167
SonicParanoid 1 1.000 - - X1462
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.