DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun2 and NSUN4

DIOPT Version :9

Sequence 1:NP_652007.1 Gene:Nsun2 / 45064 FlyBaseID:FBgn0026079 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_950245.2 Gene:NSUN4 / 387338 HGNCID:31802 Length:384 Species:Homo sapiens


Alignment Length:234 Identity:62/234 - (26%)
Similarity:99/234 - (42%) Gaps:83/234 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GGISR----------------QEAVSMIPPIVLDVRPTDKVLDMCAAPGSKT------------- 191
            |.|||                .:|.|::|.:.|.::|.|.|||:|||||.||             
Human   137 GDISRFPPARPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDLCAAPGGKTLALLQTGCCRNLA 201

  Fly   192 ---------AQLIEALHA-APEEHKIPPGFVLANDVDNNRCYMLVHQAKRLNSPCLLVTNHDSSV 246
                     |:|.:.||: .|||.:           |.|:               :.||:.|...
Human   202 ANDLSPSRIARLQKILHSYVPEEIR-----------DGNQ---------------VRVTSWDGRK 240

  Fly   247 FPNLVTTKPDGSKAILKFDKILCDVPCSGD--GTLRKNPDIWLKWNLAQAYNLHGIQYRIVRRGA 309
            :..|     :|.    .:|::|.||||:.|  ....:..:|:.:....:...|..:|.:::..|.
Human   241 WGEL-----EGD----TYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKERQILPVLQVQLLAAGL 296

  Fly   310 EMLEVGGRLVYSTCSLNPIENEAVLQRIIKDADGALELV 348
            ...:.||.:|||||||:.::||.|:|       ||:||:
Human   297 LATKPGGHVVYSTCSLSHLQNEYVVQ-------GAIELL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun2NP_652007.1 RsmB 13..433 CDD:223222 62/234 (26%)
NSUN4NP_950245.2 AdoMet_MTases 166..>325 CDD:302624 52/200 (26%)
S-adenosyl-L-methionine binding 181..187 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.