Sequence 1: | NP_652007.1 | Gene: | Nsun2 / 45064 | FlyBaseID: | FBgn0026079 | Length: | 746 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_950245.2 | Gene: | NSUN4 / 387338 | HGNCID: | 31802 | Length: | 384 | Species: | Homo sapiens |
Alignment Length: | 234 | Identity: | 62/234 - (26%) |
---|---|---|---|
Similarity: | 99/234 - (42%) | Gaps: | 83/234 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 GGISR----------------QEAVSMIPPIVLDVRPTDKVLDMCAAPGSKT------------- 191
Fly 192 ---------AQLIEALHA-APEEHKIPPGFVLANDVDNNRCYMLVHQAKRLNSPCLLVTNHDSSV 246
Fly 247 FPNLVTTKPDGSKAILKFDKILCDVPCSGD--GTLRKNPDIWLKWNLAQAYNLHGIQYRIVRRGA 309
Fly 310 EMLEVGGRLVYSTCSLNPIENEAVLQRIIKDADGALELV 348 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nsun2 | NP_652007.1 | RsmB | 13..433 | CDD:223222 | 62/234 (26%) |
NSUN4 | NP_950245.2 | AdoMet_MTases | 166..>325 | CDD:302624 | 52/200 (26%) |
S-adenosyl-L-methionine binding | 181..187 | 5/5 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0144 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |