DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun2 and Nsun4

DIOPT Version :9

Sequence 1:NP_652007.1 Gene:Nsun2 / 45064 FlyBaseID:FBgn0026079 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001100148.1 Gene:Nsun4 / 298426 RGDID:1559652 Length:381 Species:Rattus norvegicus


Alignment Length:287 Identity:74/287 - (25%)
Similarity:125/287 - (43%) Gaps:63/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DEAKALLSIIETQLFTEYVRAVAELHQKAPEDVERP-LCLPWYPNGLAYQLHLTRKDIRRSEPLY 143
            |...|.|..:..:   ::|.......:..||....| |.|...||...:.  .::.|:.|..|  
  Rat    84 DSVSAKLEQLSAK---DFVSEAISYQKLEPESGLSPTLSLDCSPNLRCFT--FSKGDVSRFPP-- 141

  Fly   144 RLHNFLIVETTAGGIS-----RQEAVSMIPPIVLDVRPTDKVLDMCAAPGSKTAQLIEALHAAPE 203
                     .:.|.:.     ..:|.|::|.:.|.::..|.|||:|||||.||..|::.      
  Rat   142 ---------ASVGSLGLMDYYLMDAASLLPVLALGLQHGDIVLDLCAAPGGKTLALLQT------ 191

  Fly   204 EHKIPPGF---VLANDVDNNR-------CYMLVHQAKRLNSPCLLVTNHDSSVFPNLVTTKPDGS 258
                  |.   :.|||:..:|       .:..|.|..|..:. :.||:.|...:..|     :|.
  Rat   192 ------GCCRNLAANDLSTSRTGRLQKVLHSYVPQDIRKGNH-IRVTSWDGRKWGEL-----EGD 244

  Fly   259 KAILKFDKILCDVPCSGD-GTLRKNP-DIWLKWNLAQAYNLHGIQYRIVRRGAEMLEVGGRLVYS 321
                .:||:|.||||:.| .:|.::. :|:.:....:...|..:|.:::..|....:.||.:|||
  Rat   245 ----TYDKVLVDVPCTTDRHSLHEDENNIFQRSRKKERQMLPMLQVQLLGAGLLATKPGGHVVYS 305

  Fly   322 TCSLNPIENEAVLQRIIKDADGALELV 348
            ||||:.::||.|:|       ||:||:
  Rat   306 TCSLSHLQNEYVVQ-------GAIELL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun2NP_652007.1 RsmB 13..433 CDD:223222 74/287 (26%)
Nsun4NP_001100148.1 AdoMet_MTases 163..>322 CDD:302624 53/187 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.