DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINB11

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:388 Identity:115/388 - (29%)
Similarity:195/388 - (50%) Gaps:39/388 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-------------ASA 81
            |..::|:.|.::...:|:..|.:|:..||.:...||.|.|..:|:|.||             .|.
Human    11 FCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDSLKPGFKDSP 75

  Fly    82 KESKDGLAESYHNLLHSYIK---SKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSR 143
            |.|:.|...|...:..|.|.   |...|.|||::|..:.:.....:...::|::.:.::.:||.:
Human    76 KCSQAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQTVDFEQ 140

  Fly   144 ETEAVEQ-INRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLS 205
            .||...: ||.||:.:|..|:..:.  .:::|.:.:.||||||||.:|...|...:|....|.||
Human   141 STEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRETVKSPFQLS 205

  Fly   206 ESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDF-- 268
            |.:::.|..|:....:..|...|...:.:||.:.|..|:|..:||...:.|:.:|::|....|  
Human   206 EGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHE 270

  Fly   269 -----NLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPI-GTR 326
                 |::|     :.|.|:||:||.|...:|...|..:|::.:|:.. ||.|.:   ||. |..
Human   271 WTSSSNMME-----REVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGM---SPTKGLY 327

  Fly   327 ITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKH--AVYFTGHI 387
            ::|..||:::||:|.|.|||.|:..:....|||:..: |.|:|||.|.||..|  .:.|.|.:
Human   328 LSKAIHKSYLDVSEEGTEAAAATGDSIAVKSLPMRAQ-FKANHPFLFFIRHTHTNTILFCGKL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 115/386 (30%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 115/388 (30%)
RCL. /evidence=ECO:0000250 341..365 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.